PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776132.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 866aa    MW: 98386.1 Da    PI: 6.6874
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776132.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR124.77.8e-081001306090
            FAR1  60 tgCkaklkvkkekdgkwevtkleleHnHela 90 
                      +C+a+l+v+++ ++kw+vtk ++eH+H+l+
  XP_009776132.1 100 ESCDAMLRVELKGQNKWVVTKYVKEHSHSLV 130
                     68***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-599130IPR004330FAR1 DNA binding domain
PfamPF105512.1E-27268359IPR018289MULE transposase domain
PfamPF044341.6E-9546580IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096611.226546582IPR007527Zinc finger, SWIM-type
SMARTSM005751.8E-6557584IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 866 aa     Download sequence    Send to blast
MDVEVIDVEQ GSMQHQGGIT DDGDDEPSES GEANVNGRSN APERDEVVEP QTGMVFHSED  60
QAKNFYDEYA RRLGFTTHVY QFNRLKTDFL CNGLRTVYGE SCDAMLRVEL KGQNKWVVTK  120
YVKEHSHSLV HPNKVHYHTS HRHFAVAKKN GPENNQGVGI VPSGVMYVSV DGNRIPLEIN  180
RGAKSTRSAE SDQTVKDNVP QSFSPRQCNQ RRTLGRDAQN LLNYFKKMQA ENPGFYYAIQ  240
LDKDNRMANV FWADARSRNA YSHFGDAVIL DTMYRVNQCR VPFAPFTGVN HHGQTILFGC  300
ALLLDESEAT FVWLFKTFLA AMNDRAPVSI ITDQDTVIQS AVAQVFPGTR HCINKWHVLR  360
GGQDRMAHVC HMYPNFQVEL YNCINLTETV EEFESYWETI LEKYDLKKND WLQSIYNTRR  420
QWVPAYFRDT FFAALSPNQE YECSFFDGYV NQQITLPLFF RQYERALENS FEKEIEADFD  480
TICTTPPLRT PSPMEKQAAT LYTKKIFLKF QEELVETFVY TANRIDGDGA LSTFRVAKFE  540
DDQKAYVVSL NISELKANCS CQMFECSGIL CRHILTVFTV TNVLTLPSHY ILKRWTINAK  600
CRAESDDHVQ LHGTESMAQK YNSLCREAIR YAEEGAVAQE TYKAALAALK EGGKKVALAK  660
RNVAKVSPPS SQVSGVGYDD RRTSASAPEM TPLLWPRQDE MTKRFNLNDT GIPARTIADL  720
NAQRMAPVSL HRGDGHADNT VILPCLKSMT WVMENKTSTP ANRVAVINLK LQDYSRTLSR  780
ESEVKFQLSR VTLEPMLKSM AYISEQLSTP ANRVAVINLK LQDTETTSGE SEVKFQVSRD  840
TLAAMLRSMA YIREQLSNTF SPVPPE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776132.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 3 isoform X2
SwissprotQ9ZVC90.0FRS3_ARATH; Protein FAR1-RELATED SEQUENCE 3
TrEMBLA0A0V0IVH00.0A0A0V0IVH0_SOLCH; Uncharacterized protein
STRINGPOPTR_0009s16010.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27110.20.0FAR1-related sequence 3